Placeholder image of a protein
Icon representing a puzzle

1747: Revisiting Puzzle 74: Platypus Venom

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
October 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,063
  2. Avatar for Contenders 12. Contenders 1 pt. 8,614
  3. Avatar for Team New Zealand 13. Team New Zealand 1 pt. 8,478
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,465
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,883
  1. Avatar for pvc78 51. pvc78 Lv 1 6 pts. 9,044
  2. Avatar for Merf 52. Merf Lv 1 6 pts. 9,028
  3. Avatar for guineapig 53. guineapig Lv 1 5 pts. 8,969
  4. Avatar for diamonddays 54. diamonddays Lv 1 5 pts. 8,922
  5. Avatar for cubbase 55. cubbase Lv 1 5 pts. 8,885
  6. Avatar for harvardman 56. harvardman Lv 1 4 pts. 8,861
  7. Avatar for justjustin 57. justjustin Lv 1 4 pts. 8,801
  8. Avatar for petetrig 58. petetrig Lv 1 4 pts. 8,796
  9. Avatar for Altercomp 59. Altercomp Lv 1 3 pts. 8,753
  10. Avatar for ManVsYard 60. ManVsYard Lv 1 3 pts. 8,749

Comments

LociOiling Lv 1

I'm still not seeing scoreboards in the client after about 12 hours. Other users are reporting the same thing.