Placeholder image of a protein
Icon representing a puzzle

1747: Revisiting Puzzle 74: Platypus Venom

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
October 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,063
  2. Avatar for Contenders 12. Contenders 1 pt. 8,614
  3. Avatar for Team New Zealand 13. Team New Zealand 1 pt. 8,478
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,465
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,883
  1. Avatar for PakElgaard 81. PakElgaard Lv 1 1 pt. 8,266
  2. Avatar for nasnad 82. nasnad Lv 1 1 pt. 8,256
  3. Avatar for rinze 83. rinze Lv 1 1 pt. 8,209
  4. Avatar for thewholeblahthing 84. thewholeblahthing Lv 1 1 pt. 8,208
  5. Avatar for hansvandenhof 85. hansvandenhof Lv 1 1 pt. 8,205
  6. Avatar for dbuske 86. dbuske Lv 1 1 pt. 8,189
  7. Avatar for roman madala 87. roman madala Lv 1 1 pt. 8,162
  8. Avatar for Willyanto 88. Willyanto Lv 1 1 pt. 8,162
  9. Avatar for ourtown 89. ourtown Lv 1 1 pt. 8,143
  10. Avatar for cobaltteal 90. cobaltteal Lv 1 1 pt. 8,121

Comments

LociOiling Lv 1

I'm still not seeing scoreboards in the client after about 12 hours. Other users are reporting the same thing.