Placeholder image of a protein
Icon representing a puzzle

1747: Revisiting Puzzle 74: Platypus Venom

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
October 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,735
  2. Avatar for Marvin's bunch 2. Marvin's bunch 70 pts. 9,718
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 9,676
  4. Avatar for HMT heritage 4. HMT heritage 30 pts. 9,669
  5. Avatar for Go Science 5. Go Science 19 pts. 9,656
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 9,647
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 9,591
  8. Avatar for Russian team 8. Russian team 4 pts. 9,511
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 9,339
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,313

  1. Avatar for mnucer 61. mnucer Lv 1 3 pts. 8,616
  2. Avatar for georg137 62. georg137 Lv 1 3 pts. 8,614
  3. Avatar for Pawel Tluscik 63. Pawel Tluscik Lv 1 2 pts. 8,560
  4. Avatar for kevin everington 64. kevin everington Lv 1 2 pts. 8,555
  5. Avatar for rypaul007 65. rypaul007 Lv 1 2 pts. 8,547
  6. Avatar for pfirth 66. pfirth Lv 1 2 pts. 8,533
  7. Avatar for anthion 67. anthion Lv 1 2 pts. 8,523
  8. Avatar for lange 68. lange Lv 1 2 pts. 8,514
  9. Avatar for Deleted player 69. Deleted player pts. 8,481
  10. Avatar for NewZealand 70. NewZealand Lv 1 1 pt. 8,478

Comments


LociOiling Lv 1

I'm still not seeing scoreboards in the client after about 12 hours. Other users are reporting the same thing.