Placeholder image of a protein
Icon representing a puzzle

1747: Revisiting Puzzle 74: Platypus Venom

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
October 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,735
  2. Avatar for Marvin's bunch 2. Marvin's bunch 70 pts. 9,718
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 9,676
  4. Avatar for HMT heritage 4. HMT heritage 30 pts. 9,669
  5. Avatar for Go Science 5. Go Science 19 pts. 9,656
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 9,647
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 9,591
  8. Avatar for Russian team 8. Russian team 4 pts. 9,511
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 9,339
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,313

  1. Avatar for ComputerMage 111. ComputerMage Lv 1 1 pt. 6,788
  2. Avatar for Gruntsar 112. Gruntsar Lv 1 1 pt. 6,585
  3. Avatar for Takashi_Yoshida 113. Takashi_Yoshida Lv 1 1 pt. 5,897
  4. Avatar for bkoep 114. bkoep Lv 1 1 pt. 5,878
  5. Avatar for JellyJump 115. JellyJump Lv 1 1 pt. 5,878

Comments


LociOiling Lv 1

I'm still not seeing scoreboards in the client after about 12 hours. Other users are reporting the same thing.