Placeholder image of a protein
Icon representing a puzzle

1747: Revisiting Puzzle 74: Platypus Venom

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,735
  2. Avatar for Marvin's bunch 2. Marvin's bunch 70 pts. 9,718
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 9,676
  4. Avatar for HMT heritage 4. HMT heritage 30 pts. 9,669
  5. Avatar for Go Science 5. Go Science 19 pts. 9,656
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 9,647
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 9,591
  8. Avatar for Russian team 8. Russian team 4 pts. 9,511
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 9,339
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,313
  1. Avatar for Alistair69 71. Alistair69 Lv 1 1 pt. 8,476
  2. Avatar for rabamino12358 72. rabamino12358 Lv 1 1 pt. 8,471
  3. Avatar for JasperD 73. JasperD Lv 1 1 pt. 8,465
  4. Avatar for lanzzz 74. lanzzz Lv 1 1 pt. 8,458
  5. Avatar for sarevok 75. sarevok Lv 1 1 pt. 8,449
  6. Avatar for rezaefar 76. rezaefar Lv 1 1 pt. 8,445
  7. Avatar for boondog 77. boondog Lv 1 1 pt. 8,364
  8. Avatar for Crossed Sticks 78. Crossed Sticks Lv 1 1 pt. 8,347
  9. Avatar for abiogenesis 79. abiogenesis Lv 1 1 pt. 8,323
  10. Avatar for hada 80. hada Lv 1 1 pt. 8,320

Comments

LociOiling Lv 1

I'm still not seeing scoreboards in the client after about 12 hours. Other users are reporting the same thing.