Placeholder image of a protein
Icon representing a puzzle

1750: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,928
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,766
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 9,564
  4. Avatar for Ukraine 14. Ukraine 1 pt. 9,555
  5. Avatar for Biology 2 15. Biology 2 1 pt. 9,163
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 8,987
  7. Avatar for Window Group 17. Window Group 1 pt. 7,652
  1. Avatar for daveed 101. daveed Lv 1 1 pt. 9,163
  2. Avatar for TyBre2019 102. TyBre2019 Lv 1 1 pt. 9,163
  3. Avatar for Vincera 103. Vincera Lv 1 1 pt. 9,152
  4. Avatar for nong9090 104. nong9090 Lv 1 1 pt. 9,145
  5. Avatar for Altercomp 105. Altercomp Lv 1 1 pt. 9,145
  6. Avatar for tstinson001 106. tstinson001 Lv 1 1 pt. 9,143
  7. Avatar for mereleona 107. mereleona Lv 1 1 pt. 9,125
  8. Avatar for justjustin 108. justjustin Lv 1 1 pt. 9,028
  9. Avatar for IHGreenman 109. IHGreenman Lv 1 1 pt. 8,998
  10. Avatar for NewZealand 110. NewZealand Lv 1 1 pt. 8,987

Comments