Placeholder image of a protein
Icon representing a puzzle

1750: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,177
  2. Avatar for Void Crushers 2. Void Crushers 73 pts. 10,144
  3. Avatar for HMT heritage 3. HMT heritage 52 pts. 10,129
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 10,129
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,116
  6. Avatar for Beta Folders 6. Beta Folders 16 pts. 10,109
  7. Avatar for Russian team 7. Russian team 10 pts. 10,074
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,061
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 10,016
  10. Avatar for Contenders 10. Contenders 2 pts. 10,001
  1. Avatar for daveed 101. daveed Lv 1 1 pt. 9,163
  2. Avatar for TyBre2019 102. TyBre2019 Lv 1 1 pt. 9,163
  3. Avatar for Vincera 103. Vincera Lv 1 1 pt. 9,152
  4. Avatar for nong9090 104. nong9090 Lv 1 1 pt. 9,145
  5. Avatar for Altercomp 105. Altercomp Lv 1 1 pt. 9,145
  6. Avatar for tstinson001 106. tstinson001 Lv 1 1 pt. 9,143
  7. Avatar for mereleona 107. mereleona Lv 1 1 pt. 9,125
  8. Avatar for justjustin 108. justjustin Lv 1 1 pt. 9,028
  9. Avatar for IHGreenman 109. IHGreenman Lv 1 1 pt. 8,998
  10. Avatar for NewZealand 110. NewZealand Lv 1 1 pt. 8,987

Comments