Placeholder image of a protein
Icon representing a puzzle

1750: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,928
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,766
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 9,564
  4. Avatar for Ukraine 14. Ukraine 1 pt. 9,555
  5. Avatar for Biology 2 15. Biology 2 1 pt. 9,163
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 8,987
  7. Avatar for Window Group 17. Window Group 1 pt. 7,652
  1. Avatar for neon_fuzz 21. neon_fuzz Lv 1 42 pts. 10,033
  2. Avatar for Anfinsen_slept_here 22. Anfinsen_slept_here Lv 1 40 pts. 10,022
  3. Avatar for silent gene 23. silent gene Lv 1 38 pts. 10,015
  4. Avatar for frood66 24. frood66 Lv 1 37 pts. 10,015
  5. Avatar for MicElephant 25. MicElephant Lv 1 35 pts. 10,003
  6. Avatar for georg137 26. georg137 Lv 1 33 pts. 10,001
  7. Avatar for NinjaGreg 27. NinjaGreg Lv 1 32 pts. 9,996
  8. Avatar for Alistair69 28. Alistair69 Lv 1 30 pts. 9,989
  9. Avatar for mnemethis 29. mnemethis Lv 1 29 pts. 9,987
  10. Avatar for pvc78 30. pvc78 Lv 1 27 pts. 9,982

Comments