Placeholder image of a protein
Icon representing a puzzle

1750: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,177
  2. Avatar for Void Crushers 2. Void Crushers 73 pts. 10,144
  3. Avatar for HMT heritage 3. HMT heritage 52 pts. 10,129
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 10,129
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,116
  6. Avatar for Beta Folders 6. Beta Folders 16 pts. 10,109
  7. Avatar for Russian team 7. Russian team 10 pts. 10,074
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,061
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 10,016
  10. Avatar for Contenders 10. Contenders 2 pts. 10,001
  1. Avatar for neon_fuzz 21. neon_fuzz Lv 1 42 pts. 10,033
  2. Avatar for Anfinsen_slept_here 22. Anfinsen_slept_here Lv 1 40 pts. 10,022
  3. Avatar for silent gene 23. silent gene Lv 1 38 pts. 10,015
  4. Avatar for frood66 24. frood66 Lv 1 37 pts. 10,015
  5. Avatar for MicElephant 25. MicElephant Lv 1 35 pts. 10,003
  6. Avatar for georg137 26. georg137 Lv 1 33 pts. 10,001
  7. Avatar for NinjaGreg 27. NinjaGreg Lv 1 32 pts. 9,996
  8. Avatar for Alistair69 28. Alistair69 Lv 1 30 pts. 9,989
  9. Avatar for mnemethis 29. mnemethis Lv 1 29 pts. 9,987
  10. Avatar for pvc78 30. pvc78 Lv 1 27 pts. 9,982

Comments