Placeholder image of a protein
Icon representing a puzzle

1750: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,928
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,766
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 9,564
  4. Avatar for Ukraine 14. Ukraine 1 pt. 9,555
  5. Avatar for Biology 2 15. Biology 2 1 pt. 9,163
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 8,987
  7. Avatar for Window Group 17. Window Group 1 pt. 7,652
  1. Avatar for alcor29 41. alcor29 Lv 1 15 pts. 9,906
  2. Avatar for Silvercraft 42. Silvercraft Lv 1 14 pts. 9,901
  3. Avatar for phi16 43. phi16 Lv 1 13 pts. 9,888
  4. Avatar for WBarme1234 44. WBarme1234 Lv 1 13 pts. 9,882
  5. Avatar for cobaltteal 45. cobaltteal Lv 1 12 pts. 9,871
  6. Avatar for hansvandenhof 46. hansvandenhof Lv 1 11 pts. 9,870
  7. Avatar for fpc 47. fpc Lv 1 11 pts. 9,866
  8. Avatar for Merf 48. Merf Lv 1 10 pts. 9,862
  9. Avatar for Idiotboy 49. Idiotboy Lv 1 9 pts. 9,853
  10. Avatar for PeterDav 50. PeterDav Lv 1 9 pts. 9,849

Comments