Placeholder image of a protein
Icon representing a puzzle

1750: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
October 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Go Science 100 pts. 10,177
  2. Avatar for Void Crushers 2. Void Crushers 73 pts. 10,144
  3. Avatar for HMT heritage 3. HMT heritage 52 pts. 10,129
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 10,129
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,116
  6. Avatar for Beta Folders 6. Beta Folders 16 pts. 10,109
  7. Avatar for Russian team 7. Russian team 10 pts. 10,074
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,061
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 10,016
  10. Avatar for Contenders 10. Contenders 2 pts. 10,001

  1. Avatar for alcor29 41. alcor29 Lv 1 15 pts. 9,906
  2. Avatar for Silvercraft 42. Silvercraft Lv 1 14 pts. 9,901
  3. Avatar for phi16 43. phi16 Lv 1 13 pts. 9,888
  4. Avatar for WBarme1234 44. WBarme1234 Lv 1 13 pts. 9,882
  5. Avatar for cobaltteal 45. cobaltteal Lv 1 12 pts. 9,871
  6. Avatar for hansvandenhof 46. hansvandenhof Lv 1 11 pts. 9,870
  7. Avatar for fpc 47. fpc Lv 1 11 pts. 9,866
  8. Avatar for Merf 48. Merf Lv 1 10 pts. 9,862
  9. Avatar for Idiotboy 49. Idiotboy Lv 1 9 pts. 9,853
  10. Avatar for PeterDav 50. PeterDav Lv 1 9 pts. 9,849

Comments