Placeholder image of a protein
Icon representing a puzzle

1750: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
October 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,928
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,766
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 9,564
  4. Avatar for Ukraine 14. Ukraine 1 pt. 9,555
  5. Avatar for Biology 2 15. Biology 2 1 pt. 9,163
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 8,987
  7. Avatar for Window Group 17. Window Group 1 pt. 7,652

  1. Avatar for joaniegirl 51. joaniegirl Lv 1 8 pts. 9,848
  2. Avatar for borattt 52. borattt Lv 1 8 pts. 9,840
  3. Avatar for INTAE 53. INTAE Lv 1 7 pts. 9,790
  4. Avatar for Vinara 54. Vinara Lv 1 7 pts. 9,787
  5. Avatar for dcrwheeler 55. dcrwheeler Lv 1 6 pts. 9,781
  6. Avatar for lconor 56. lconor Lv 1 6 pts. 9,780
  7. Avatar for dd-2 57. dd-2 Lv 1 6 pts. 9,771
  8. Avatar for jamiexq 58. jamiexq Lv 1 5 pts. 9,770
  9. Avatar for JasperD 59. JasperD Lv 1 5 pts. 9,766
  10. Avatar for id566488 60. id566488 Lv 1 5 pts. 9,748

Comments