Placeholder image of a protein
Icon representing a puzzle

1750: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Go Science 100 pts. 10,177
  2. Avatar for Void Crushers 2. Void Crushers 73 pts. 10,144
  3. Avatar for HMT heritage 3. HMT heritage 52 pts. 10,129
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 10,129
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,116
  6. Avatar for Beta Folders 6. Beta Folders 16 pts. 10,109
  7. Avatar for Russian team 7. Russian team 10 pts. 10,074
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,061
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 10,016
  10. Avatar for Contenders 10. Contenders 2 pts. 10,001

  1. Avatar for joaniegirl 51. joaniegirl Lv 1 8 pts. 9,848
  2. Avatar for borattt 52. borattt Lv 1 8 pts. 9,840
  3. Avatar for INTAE 53. INTAE Lv 1 7 pts. 9,790
  4. Avatar for Vinara 54. Vinara Lv 1 7 pts. 9,787
  5. Avatar for dcrwheeler 55. dcrwheeler Lv 1 6 pts. 9,781
  6. Avatar for lconor 56. lconor Lv 1 6 pts. 9,780
  7. Avatar for dd-2 57. dd-2 Lv 1 6 pts. 9,771
  8. Avatar for jamiexq 58. jamiexq Lv 1 5 pts. 9,770
  9. Avatar for JasperD 59. JasperD Lv 1 5 pts. 9,766
  10. Avatar for id566488 60. id566488 Lv 1 5 pts. 9,748

Comments