Placeholder image of a protein
Icon representing a puzzle

1750: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
October 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,928
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,766
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 9,564
  4. Avatar for Ukraine 14. Ukraine 1 pt. 9,555
  5. Avatar for Biology 2 15. Biology 2 1 pt. 9,163
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 8,987
  7. Avatar for Window Group 17. Window Group 1 pt. 7,652

  1. Avatar for hada 61. hada Lv 1 4 pts. 9,745
  2. Avatar for Pawel Tluscik 62. Pawel Tluscik Lv 1 4 pts. 9,734
  3. Avatar for heather-1 63. heather-1 Lv 1 4 pts. 9,731
  4. Avatar for gurch 64. gurch Lv 1 4 pts. 9,720
  5. Avatar for rabamino12358 65. rabamino12358 Lv 1 3 pts. 9,712
  6. Avatar for frostschutz 66. frostschutz Lv 1 3 pts. 9,708
  7. Avatar for NicksterStudios 67. NicksterStudios Lv 1 3 pts. 9,703
  8. Avatar for DoctorSockrates 68. DoctorSockrates Lv 1 3 pts. 9,697
  9. Avatar for mnucer 69. mnucer Lv 1 2 pts. 9,670
  10. Avatar for Glen B 70. Glen B Lv 1 2 pts. 9,663

Comments