Placeholder image of a protein
Icon representing a puzzle

1750: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,177
  2. Avatar for Void Crushers 2. Void Crushers 73 pts. 10,144
  3. Avatar for HMT heritage 3. HMT heritage 52 pts. 10,129
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 10,129
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,116
  6. Avatar for Beta Folders 6. Beta Folders 16 pts. 10,109
  7. Avatar for Russian team 7. Russian team 10 pts. 10,074
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,061
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 10,016
  10. Avatar for Contenders 10. Contenders 2 pts. 10,001
  1. Avatar for hada 61. hada Lv 1 4 pts. 9,745
  2. Avatar for Pawel Tluscik 62. Pawel Tluscik Lv 1 4 pts. 9,734
  3. Avatar for heather-1 63. heather-1 Lv 1 4 pts. 9,731
  4. Avatar for gurch 64. gurch Lv 1 4 pts. 9,720
  5. Avatar for rabamino12358 65. rabamino12358 Lv 1 3 pts. 9,712
  6. Avatar for frostschutz 66. frostschutz Lv 1 3 pts. 9,708
  7. Avatar for NicksterStudios 67. NicksterStudios Lv 1 3 pts. 9,703
  8. Avatar for DoctorSockrates 68. DoctorSockrates Lv 1 3 pts. 9,697
  9. Avatar for mnucer 69. mnucer Lv 1 2 pts. 9,670
  10. Avatar for Glen B 70. Glen B Lv 1 2 pts. 9,663

Comments