Placeholder image of a protein
Icon representing a puzzle

1750: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,928
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,766
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 9,564
  4. Avatar for Ukraine 14. Ukraine 1 pt. 9,555
  5. Avatar for Biology 2 15. Biology 2 1 pt. 9,163
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 8,987
  7. Avatar for Window Group 17. Window Group 1 pt. 7,652
  1. Avatar for Willyanto 71. Willyanto Lv 1 2 pts. 9,647
  2. Avatar for CAN1958 72. CAN1958 Lv 1 2 pts. 9,636
  3. Avatar for Hellcat6 73. Hellcat6 Lv 1 2 pts. 9,626
  4. Avatar for Arne Heessels 74. Arne Heessels Lv 1 2 pts. 9,596
  5. Avatar for harvardman 75. harvardman Lv 1 2 pts. 9,569
  6. Avatar for atlas100 76. atlas100 Lv 1 2 pts. 9,567
  7. Avatar for aspadistra 77. aspadistra Lv 1 1 pt. 9,564
  8. Avatar for Commaster 78. Commaster Lv 1 1 pt. 9,555
  9. Avatar for tamanrasset 79. tamanrasset Lv 1 1 pt. 9,543
  10. Avatar for dahast.de 80. dahast.de Lv 1 1 pt. 9,520

Comments