Placeholder image of a protein
Icon representing a puzzle

1750: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,177
  2. Avatar for Void Crushers 2. Void Crushers 73 pts. 10,144
  3. Avatar for HMT heritage 3. HMT heritage 52 pts. 10,129
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 10,129
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,116
  6. Avatar for Beta Folders 6. Beta Folders 16 pts. 10,109
  7. Avatar for Russian team 7. Russian team 10 pts. 10,074
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,061
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 10,016
  10. Avatar for Contenders 10. Contenders 2 pts. 10,001
  1. Avatar for Willyanto 71. Willyanto Lv 1 2 pts. 9,647
  2. Avatar for CAN1958 72. CAN1958 Lv 1 2 pts. 9,636
  3. Avatar for Hellcat6 73. Hellcat6 Lv 1 2 pts. 9,626
  4. Avatar for Arne Heessels 74. Arne Heessels Lv 1 2 pts. 9,596
  5. Avatar for harvardman 75. harvardman Lv 1 2 pts. 9,569
  6. Avatar for atlas100 76. atlas100 Lv 1 2 pts. 9,567
  7. Avatar for aspadistra 77. aspadistra Lv 1 1 pt. 9,564
  8. Avatar for Commaster 78. Commaster Lv 1 1 pt. 9,555
  9. Avatar for tamanrasset 79. tamanrasset Lv 1 1 pt. 9,543
  10. Avatar for dahast.de 80. dahast.de Lv 1 1 pt. 9,520

Comments