Placeholder image of a protein
Icon representing a puzzle

1751: Unsolved De-novo Freestyle 156

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups

  1. Avatar for Contenders 11. Contenders 1 pt. 9,436
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,997
  3. Avatar for Ukraine 13. Ukraine 1 pt. 8,969
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 8,798
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,299
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0
  7. Avatar for Deleted group 17. Deleted group pts. 0
  1. Avatar for JellyJump 121. JellyJump Lv 1 1 pt. 0
  2. Avatar for atlas100 122. atlas100 Lv 1 1 pt. 0
  3. Avatar for Idiotboy 123. Idiotboy Lv 1 1 pt. 0
  4. Avatar for alcor29 124. alcor29 Lv 1 1 pt. 0
  5. Avatar for rmoretti 125. rmoretti Lv 1 1 pt. 0
  6. Avatar for Hollinas 126. Hollinas Lv 1 1 pt. 0
  7. Avatar for Jaylin_M 127. Jaylin_M Lv 1 1 pt. 0

Comments