Placeholder image of a protein
Icon representing a puzzle

1751: Unsolved De-novo Freestyle 156

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups

  1. Avatar for Contenders 11. Contenders 1 pt. 9,436
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,997
  3. Avatar for Ukraine 13. Ukraine 1 pt. 8,969
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 8,798
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,299
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0
  7. Avatar for Deleted group 17. Deleted group pts. 0
  1. Avatar for neon_fuzz 41. neon_fuzz Lv 1 15 pts. 9,517
  2. Avatar for id566488 42. id566488 Lv 1 14 pts. 9,506
  3. Avatar for pvc78 43. pvc78 Lv 1 14 pts. 9,503
  4. Avatar for Altercomp 44. Altercomp Lv 1 13 pts. 9,501
  5. Avatar for nicobul 45. nicobul Lv 1 12 pts. 9,490
  6. Avatar for PakElgaard 46. PakElgaard Lv 1 11 pts. 9,489
  7. Avatar for Steven Pletsch 47. Steven Pletsch Lv 1 11 pts. 9,487
  8. Avatar for ManVsYard 48. ManVsYard Lv 1 10 pts. 9,455
  9. Avatar for grogar7 49. grogar7 Lv 1 10 pts. 9,447
  10. Avatar for heather-1 50. heather-1 Lv 1 9 pts. 9,436

Comments