Placeholder image of a protein
Icon representing a puzzle

1751: Unsolved De-novo Freestyle 156

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,231
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,039
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 9,999
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,971
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,941
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 16 pts. 9,934
  7. Avatar for Russian team 7. Russian team 10 pts. 9,886
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,839
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,836
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,487
  1. Avatar for guineapig 21. guineapig Lv 1 43 pts. 9,784
  2. Avatar for mnemethis 22. mnemethis Lv 1 41 pts. 9,782
  3. Avatar for silent gene 23. silent gene Lv 1 39 pts. 9,771
  4. Avatar for Skippysk8s 24. Skippysk8s Lv 1 37 pts. 9,747
  5. Avatar for Aubade01 25. Aubade01 Lv 1 35 pts. 9,734
  6. Avatar for NinjaGreg 26. NinjaGreg Lv 1 34 pts. 9,698
  7. Avatar for robgee 27. robgee Lv 1 32 pts. 9,691
  8. Avatar for Hellcat6 28. Hellcat6 Lv 1 30 pts. 9,688
  9. Avatar for MicElephant 29. MicElephant Lv 1 29 pts. 9,672
  10. Avatar for WBarme1234 30. WBarme1234 Lv 1 28 pts. 9,670

Comments