Placeholder image of a protein
Icon representing a puzzle

1751: Unsolved De-novo Freestyle 156

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,231
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,039
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 9,999
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,971
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,941
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 16 pts. 9,934
  7. Avatar for Russian team 7. Russian team 10 pts. 9,886
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,839
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,836
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,487
  1. Avatar for DoctorSockrates 61. DoctorSockrates Lv 1 4 pts. 9,252
  2. Avatar for jausmh 62. jausmh Lv 1 4 pts. 9,227
  3. Avatar for ViJay7019 63. ViJay7019 Lv 1 4 pts. 9,215
  4. Avatar for cbwest 64. cbwest Lv 1 4 pts. 9,207
  5. Avatar for Gulumee 65. Gulumee Lv 1 3 pts. 9,199
  6. Avatar for TastyMunchies 66. TastyMunchies Lv 1 3 pts. 9,184
  7. Avatar for Palenta 67. Palenta Lv 1 3 pts. 9,183
  8. Avatar for drumpeter18yrs9yrs 68. drumpeter18yrs9yrs Lv 1 3 pts. 9,153
  9. Avatar for rezaefar 69. rezaefar Lv 1 3 pts. 9,147
  10. Avatar for libellule 70. libellule Lv 1 2 pts. 9,103

Comments