Foldit

1754: Unsolved De-novo Freestyle 156: Symmetric Trimer

Closed since over 6 years ago

Intermediate Overall Prediction Symmetry

Summary

Created: October 31, 2019
Expires: November 07, 2019 at 23:00 UTC
Max points: 100

Description

This is a follow-up to Puzzle 1751: De-novo Freestyle 156, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric ~~dimer~~ trimer. In Puzzle 1751, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C3 symmetry. Players may load in solutions from Puzzle 1751. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD