Placeholder image of a protein
Icon representing a puzzle

1754: Unsolved De-novo Freestyle 156: Symmetric Trimer

Closed since over 6 years ago

Intermediate Overall Prediction Symmetry

Summary


Created
October 31, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1751: De-novo Freestyle 156, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer trimer. In Puzzle 1751, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C3 symmetry. Players may load in solutions from Puzzle 1751. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 12,717
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,968
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,568
  4. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 5,788

  1. Avatar for 01010011111 101. 01010011111 Lv 1 1 pt. 2,180
  2. Avatar for minjun8898 102. minjun8898 Lv 1 1 pt. 399
  3. Avatar for darrickyu 103. darrickyu Lv 1 1 pt. 215
  4. Avatar for gleep314 104. gleep314 Lv 1 1 pt. 177
  5. Avatar for BRGRO19 105. BRGRO19 Lv 1 1 pt. 0
  6. Avatar for Vincera 106. Vincera Lv 1 1 pt. 0
  7. Avatar for Hollinas 107. Hollinas Lv 1 1 pt. 0
  8. Avatar for jseckler 108. jseckler Lv 1 1 pt. 0
  9. Avatar for Blipperman 109. Blipperman Lv 1 1 pt. 0

Comments