Placeholder image of a protein
Icon representing a puzzle

1754: Unsolved De-novo Freestyle 156: Symmetric Trimer

Closed since over 6 years ago

Intermediate Overall Prediction Symmetry

Summary


Created
October 31, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1751: De-novo Freestyle 156, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer trimer. In Puzzle 1751, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C3 symmetry. Players may load in solutions from Puzzle 1751. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 12,717
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,968
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,568
  4. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 5,788

  1. Avatar for Glen B 11. Glen B Lv 1 63 pts. 13,821
  2. Avatar for O Seki To 12. O Seki To Lv 1 60 pts. 13,802
  3. Avatar for Bletchley Park 13. Bletchley Park Lv 1 57 pts. 13,678
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 54 pts. 13,641
  5. Avatar for Phyx 15. Phyx Lv 1 52 pts. 13,611
  6. Avatar for fiendish_ghoul 16. fiendish_ghoul Lv 1 49 pts. 13,602
  7. Avatar for Deleted player 17. Deleted player pts. 13,594
  8. Avatar for frood66 18. frood66 Lv 1 44 pts. 13,546
  9. Avatar for Timo van der Laan 19. Timo van der Laan Lv 1 42 pts. 13,537
  10. Avatar for vakobo 20. vakobo Lv 1 40 pts. 13,524

Comments