Placeholder image of a protein
Icon representing a puzzle

1754: Unsolved De-novo Freestyle 156: Symmetric Trimer

Closed since over 6 years ago

Intermediate Overall Prediction Symmetry

Summary


Created
October 31, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1751: De-novo Freestyle 156, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer trimer. In Puzzle 1751, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C3 symmetry. Players may load in solutions from Puzzle 1751. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 12,717
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,968
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,568
  4. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 5,788

  1. Avatar for Marvelz 21. Marvelz Lv 1 38 pts. 13,497
  2. Avatar for Dhalion 22. Dhalion Lv 1 36 pts. 13,485
  3. Avatar for guineapig 23. guineapig Lv 1 34 pts. 13,469
  4. Avatar for toshiue 24. toshiue Lv 1 32 pts. 13,423
  5. Avatar for MicElephant 25. MicElephant Lv 1 30 pts. 13,361
  6. Avatar for robgee 26. robgee Lv 1 29 pts. 13,354
  7. Avatar for Vinara 27. Vinara Lv 1 27 pts. 13,292
  8. Avatar for johnmitch 28. johnmitch Lv 1 26 pts. 13,248
  9. Avatar for drumpeter18yrs9yrs 29. drumpeter18yrs9yrs Lv 1 24 pts. 13,224
  10. Avatar for phi16 30. phi16 Lv 1 23 pts. 13,204

Comments