Placeholder image of a protein
Icon representing a puzzle

1754: Unsolved De-novo Freestyle 156: Symmetric Trimer

Closed since over 6 years ago

Intermediate Overall Prediction Symmetry

Summary


Created
October 31, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1751: De-novo Freestyle 156, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer trimer. In Puzzle 1751, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C3 symmetry. Players may load in solutions from Puzzle 1751. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 12,717
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,968
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,568
  4. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 5,788

  1. Avatar for grogar7 31. grogar7 Lv 1 22 pts. 13,158
  2. Avatar for jobo0502 32. jobo0502 Lv 1 20 pts. 13,124
  3. Avatar for neon_fuzz 33. neon_fuzz Lv 1 19 pts. 13,027
  4. Avatar for silent gene 34. silent gene Lv 1 18 pts. 12,980
  5. Avatar for WBarme1234 35. WBarme1234 Lv 1 17 pts. 12,912
  6. Avatar for Mike Cassidy 36. Mike Cassidy Lv 1 16 pts. 12,783
  7. Avatar for Steven Pletsch 37. Steven Pletsch Lv 1 15 pts. 12,717
  8. Avatar for diamonddays 38. diamonddays Lv 1 14 pts. 12,694
  9. Avatar for fpc 39. fpc Lv 1 13 pts. 12,690
  10. Avatar for jausmh 40. jausmh Lv 1 12 pts. 12,471

Comments