Placeholder image of a protein
Icon representing a puzzle

1754: Unsolved De-novo Freestyle 156: Symmetric Trimer

Closed since over 6 years ago

Intermediate Overall Prediction Symmetry

Summary

Created
October 31, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1751: De-novo Freestyle 156, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer trimer. In Puzzle 1751, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C3 symmetry. Players may load in solutions from Puzzle 1751. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 12,717
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,968
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,568
  4. Avatar for Boise State Drug Discovery and Design Class 14. Boise State Drug Discovery and Design Class 1 pt. 9,128
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 5,788
  1. Avatar for Gulumee 61. Gulumee Lv 1 3 pts. 11,622
  2. Avatar for martin.szew 62. martin.szew Lv 1 2 pts. 11,555
  3. Avatar for pvc78 63. pvc78 Lv 1 2 pts. 11,474
  4. Avatar for atlas100 64. atlas100 Lv 1 2 pts. 11,368
  5. Avatar for abiogenesis 65. abiogenesis Lv 1 2 pts. 11,354
  6. Avatar for Pawel Tluscik 66. Pawel Tluscik Lv 1 2 pts. 11,338
  7. Avatar for rabamino12358 67. rabamino12358 Lv 1 2 pts. 11,293
  8. Avatar for Hellcat6 68. Hellcat6 Lv 1 2 pts. 11,092
  9. Avatar for libellule 69. libellule Lv 1 1 pt. 10,958
  10. Avatar for pfirth 70. pfirth Lv 1 1 pt. 10,931

Comments