Placeholder image of a protein
Icon representing a puzzle

1754: Unsolved De-novo Freestyle 156: Symmetric Trimer

Closed since over 6 years ago

Intermediate Overall Prediction Symmetry

Summary

Created
October 31, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1751: De-novo Freestyle 156, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer trimer. In Puzzle 1751, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C3 symmetry. Players may load in solutions from Puzzle 1751. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 12,717
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,968
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,568
  4. Avatar for Boise State Drug Discovery and Design Class 14. Boise State Drug Discovery and Design Class 1 pt. 9,128
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 5,788
  1. Avatar for Arne Heessels 71. Arne Heessels Lv 1 1 pt. 10,815
  2. Avatar for aznarog 72. aznarog Lv 1 1 pt. 10,759
  3. Avatar for henrygi 73. henrygi Lv 1 1 pt. 10,710
  4. Avatar for lange 74. lange Lv 1 1 pt. 10,662
  5. Avatar for Astralist 75. Astralist Lv 1 1 pt. 9,970
  6. Avatar for bobcat 76. bobcat Lv 1 1 pt. 9,891
  7. Avatar for petetrig 77. petetrig Lv 1 1 pt. 9,712
  8. Avatar for rinze 78. rinze Lv 1 1 pt. 9,597
  9. Avatar for alyssa_d_V2.0 79. alyssa_d_V2.0 Lv 1 1 pt. 9,568
  10. Avatar for Willyanto 80. Willyanto Lv 1 1 pt. 9,193

Comments