LociOiling Lv 1
The puzzle description says "dimer", but the actual puzzle has a monomer plus two symmetric copies.
1754: Unsolved De-novo Freestyle 156: Symmetric Trimer
Closed since over 6 years ago
Intermediate Overall Prediction SymmetrySummary
- Created
- October 31, 2019
- Expires
- Max points
- 100
This is a follow-up to Puzzle 1751: De-novo Freestyle 156, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer trimer. In Puzzle 1751, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C3 symmetry. Players may load in solutions from Puzzle 1751. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!
Sequence:
AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD
Top groups
Comments
LociOiling Lv 1
The link says puzzle 1751, but it actually goes to the puzzle 1691 page. Puzzle 1751 is correct.
bkoep Staff Lv 1
We fixed the link to go the correct puzzle page.