Placeholder image of a protein
Icon representing a puzzle

1754: Unsolved De-novo Freestyle 156: Symmetric Trimer

Closed since over 6 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Symmetry Symmetry

Summary


Created
October 31, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1751: De-novo Freestyle 156, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer trimer. In Puzzle 1751, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C3 symmetry. Players may load in solutions from Puzzle 1751. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups


  1. Avatar for Go Science 100 pts. 14,632
  2. Avatar for Gargleblasters 2. Gargleblasters 70 pts. 14,532
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 14,176
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 14,078
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 13,969
  6. Avatar for HMT heritage 6. HMT heritage 11 pts. 13,802
  7. Avatar for Contenders 7. Contenders 7 pts. 13,678
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 13,592
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 13,537
  10. Avatar for Russian team 10. Russian team 1 pt. 13,524

  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 14,560
  2. Avatar for Enzyme 2. Enzyme Lv 1 96 pts. 14,532
  3. Avatar for Anfinsen_slept_here 3. Anfinsen_slept_here Lv 1 92 pts. 14,391
  4. Avatar for Galaxie 4. Galaxie Lv 1 88 pts. 14,175
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 84 pts. 14,004
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 80 pts. 13,969
  7. Avatar for LociOiling 7. LociOiling Lv 1 76 pts. 13,963
  8. Avatar for dcrwheeler 8. dcrwheeler Lv 1 73 pts. 13,952
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 70 pts. 13,941
  10. Avatar for nicobul 10. nicobul Lv 1 66 pts. 13,934

Comments