Placeholder image of a protein
Icon representing a puzzle

1756: Revisiting Puzzle 77: Copper Chaperone

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 06, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,476
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 9,349
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,340
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,134
  1. Avatar for heyubob 101. heyubob Lv 1 1 pt. 8,883
  2. Avatar for upstreak1 102. upstreak1 Lv 1 1 pt. 8,865
  3. Avatar for zid 103. zid Lv 1 1 pt. 8,851
  4. Avatar for carsonfb 104. carsonfb Lv 1 1 pt. 8,827
  5. Avatar for Hollinas 105. Hollinas Lv 1 1 pt. 8,822
  6. Avatar for Kim Ye-eun 106. Kim Ye-eun Lv 1 1 pt. 8,818
  7. Avatar for lange 107. lange Lv 1 1 pt. 8,793
  8. Avatar for DipsyDoodle2016 108. DipsyDoodle2016 Lv 1 1 pt. 8,708
  9. Avatar for jdmclure 109. jdmclure Lv 1 1 pt. 8,702
  10. Avatar for multaq 110. multaq Lv 1 1 pt. 8,643

Comments