Placeholder image of a protein
Icon representing a puzzle

1756: Revisiting Puzzle 77: Copper Chaperone

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 06, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,345
  2. Avatar for Go Science 2. Go Science 68 pts. 10,335
  3. Avatar for Gargleblasters 3. Gargleblasters 44 pts. 10,255
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,230
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,204
  6. Avatar for Russian team 6. Russian team 9 pts. 10,203
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 5 pts. 10,140
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 10,047
  9. Avatar for Contenders 9. Contenders 1 pt. 9,834
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 9,492
  1. Avatar for heyubob 101. heyubob Lv 1 1 pt. 8,883
  2. Avatar for upstreak1 102. upstreak1 Lv 1 1 pt. 8,865
  3. Avatar for zid 103. zid Lv 1 1 pt. 8,851
  4. Avatar for carsonfb 104. carsonfb Lv 1 1 pt. 8,827
  5. Avatar for Hollinas 105. Hollinas Lv 1 1 pt. 8,822
  6. Avatar for Kim Ye-eun 106. Kim Ye-eun Lv 1 1 pt. 8,818
  7. Avatar for lange 107. lange Lv 1 1 pt. 8,793
  8. Avatar for DipsyDoodle2016 108. DipsyDoodle2016 Lv 1 1 pt. 8,708
  9. Avatar for jdmclure 109. jdmclure Lv 1 1 pt. 8,702
  10. Avatar for multaq 110. multaq Lv 1 1 pt. 8,643

Comments