Placeholder image of a protein
Icon representing a puzzle

1756: Revisiting Puzzle 77: Copper Chaperone

Closed since over 6 years ago

Intermediate Overall Prediction

Summary


Created
November 06, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Beta Folders 100 pts. 10,345
  2. Avatar for Go Science 2. Go Science 68 pts. 10,335
  3. Avatar for Gargleblasters 3. Gargleblasters 44 pts. 10,255
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,230
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,204
  6. Avatar for Russian team 6. Russian team 9 pts. 10,203
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 5 pts. 10,140
  8. Avatar for HMT heritage 8. HMT heritage 3 pts. 10,047
  9. Avatar for Contenders 9. Contenders 1 pt. 9,834
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 9,492

  1. Avatar for jamiexq 81. jamiexq Lv 1 1 pt. 9,207
  2. Avatar for navn 82. navn Lv 1 1 pt. 9,199
  3. Avatar for Merf 83. Merf Lv 1 1 pt. 9,198
  4. Avatar for cobaltteal 84. cobaltteal Lv 1 1 pt. 9,177
  5. Avatar for kevin everington 85. kevin everington Lv 1 1 pt. 9,167
  6. Avatar for abiogenesis 86. abiogenesis Lv 1 1 pt. 9,166
  7. Avatar for RockOn 87. RockOn Lv 1 1 pt. 9,154
  8. Avatar for alyssa_d_V2.0 88. alyssa_d_V2.0 Lv 1 1 pt. 9,134
  9. Avatar for rinze 89. rinze Lv 1 1 pt. 9,115
  10. Avatar for xbp 90. xbp Lv 1 1 pt. 9,086

Comments