Placeholder image of a protein
Icon representing a puzzle

1757: Unsolved De-novo Freestyle 157

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups

  1. Avatar for Contenders 11. Contenders 1 pt. 9,534
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 9,520
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,451
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 8,962
  5. Avatar for Team Schleswig-Holstein 15. Team Schleswig-Holstein 1 pt. 8,688
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 8,479
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 7,648
  1. Avatar for robgee 21. robgee Lv 1 42 pts. 9,709
  2. Avatar for silent gene 22. silent gene Lv 1 40 pts. 9,701
  3. Avatar for Steven Pletsch 23. Steven Pletsch Lv 1 38 pts. 9,688
  4. Avatar for anthion 24. anthion Lv 1 36 pts. 9,680
  5. Avatar for johnmitch 25. johnmitch Lv 1 34 pts. 9,662
  6. Avatar for heather-1 26. heather-1 Lv 1 33 pts. 9,655
  7. Avatar for Dhalion 27. Dhalion Lv 1 31 pts. 9,652
  8. Avatar for jobo0502 28. jobo0502 Lv 1 29 pts. 9,650
  9. Avatar for Threeoak 29. Threeoak Lv 1 28 pts. 9,630
  10. Avatar for RockOn 30. RockOn Lv 1 27 pts. 9,618

Comments