Placeholder image of a protein
Icon representing a puzzle

1757: Unsolved De-novo Freestyle 157

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups

  1. Avatar for Contenders 11. Contenders 1 pt. 9,534
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 9,520
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,451
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 8,962
  5. Avatar for Team Schleswig-Holstein 15. Team Schleswig-Holstein 1 pt. 8,688
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 8,479
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 7,648
  1. Avatar for PeterDav 61. PeterDav Lv 1 4 pts. 9,365
  2. Avatar for andrewtmaxwell 62. andrewtmaxwell Lv 1 4 pts. 9,361
  3. Avatar for Vincera 63. Vincera Lv 1 4 pts. 9,359
  4. Avatar for diamonddays 64. diamonddays Lv 1 3 pts. 9,352
  5. Avatar for neon_fuzz 65. neon_fuzz Lv 1 3 pts. 9,331
  6. Avatar for spvincent 66. spvincent Lv 1 3 pts. 9,315
  7. Avatar for CAN1958 67. CAN1958 Lv 1 3 pts. 9,311
  8. Avatar for alcor29 68. alcor29 Lv 1 2 pts. 9,292
  9. Avatar for 15SecNut 69. 15SecNut Lv 1 2 pts. 9,279
  10. Avatar for thewholeblahthing 70. thewholeblahthing Lv 1 2 pts. 9,257

Comments