Placeholder image of a protein
Icon representing a puzzle

1757: Unsolved De-novo Freestyle 157

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups

  1. Avatar for Contenders 11. Contenders 1 pt. 9,534
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 9,520
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,451
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 8,962
  5. Avatar for Team Schleswig-Holstein 15. Team Schleswig-Holstein 1 pt. 8,688
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 8,479
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 7,648
  1. Avatar for Merf 81. Merf Lv 1 1 pt. 9,091
  2. Avatar for tarimo 82. tarimo Lv 1 1 pt. 9,077
  3. Avatar for DipsyDoodle2016 83. DipsyDoodle2016 Lv 1 1 pt. 9,061
  4. Avatar for arcsign 84. arcsign Lv 1 1 pt. 9,028
  5. Avatar for rabamino12358 85. rabamino12358 Lv 1 1 pt. 8,994
  6. Avatar for versat82 86. versat82 Lv 1 1 pt. 8,962
  7. Avatar for multaq 87. multaq Lv 1 1 pt. 8,875
  8. Avatar for froggs554 88. froggs554 Lv 1 1 pt. 8,812
  9. Avatar for abiogenesis 89. abiogenesis Lv 1 1 pt. 8,742
  10. Avatar for jdmclure 90. jdmclure Lv 1 1 pt. 8,727

Comments