Placeholder image of a protein
Icon representing a puzzle

1760: Unsolved De-novo Freestyle 157: Symmetric Trimer

Closed since over 6 years ago

Intermediate Intermediate

Summary


Created
November 14, 2019
Expires
Max points
100
Description

Note: This puzzle was mistakenly posted with the wrong sequence, and has been closed and reposted as Puzzle 1760b.



This is a follow-up to Puzzle 1757: De-novo Freestyle 157, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric trimer. In Puzzle 1757, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C3 symmetry. Players may load in solutions from Puzzle 1757. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups


  1. Avatar for Gargleblasters 100 pts. 13,646
  2. Avatar for Go Science 2. Go Science 4 pts. 11,992
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 1 pt. 8,177

  1. Avatar for Enzyme
    1. Enzyme Lv 1
    100 pts. 13,646
  2. Avatar for NinjaGreg 2. NinjaGreg Lv 1 56 pts. 11,992
  3. Avatar for Phyx 3. Phyx Lv 1 29 pts. 11,613
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 14 pts. 11,256
  5. Avatar for Hellcat6 5. Hellcat6 Lv 1 6 pts. 9,724
  6. Avatar for Pawel Tluscik 6. Pawel Tluscik Lv 1 2 pts. 9,408
  7. Avatar for Galaxie 7. Galaxie Lv 1 1 pt. 8,177
  8. Avatar for ZeroLeak7 8. ZeroLeak7 Lv 1 1 pt. 8,170
  9. Avatar for bkoep 9. bkoep Lv 1 1 pt. 0
  10. Avatar for Glen B 10. Glen B Lv 1 1 pt. 0

Comments