Placeholder image of a protein
Icon representing a puzzle

1762: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 2 pts. 9,530
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,129
  3. Avatar for Contenders 13. Contenders 1 pt. 9,064
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,786
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 8,737
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 8,737
  7. Avatar for Team Schleswig-Holstein 17. Team Schleswig-Holstein 1 pt. 7,778
  8. Avatar for STME 1903 18. STME 1903 1 pt. 3,334
  1. Avatar for rws 91. rws Lv 1 1 pt. 8,131
  2. Avatar for AlecM 92. AlecM Lv 1 1 pt. 8,029
  3. Avatar for Kayoung 93. Kayoung Lv 1 1 pt. 7,996
  4. Avatar for Deleted player 94. Deleted player pts. 7,995
  5. Avatar for marcramossala 95. marcramossala Lv 1 1 pt. 7,846
  6. Avatar for Asma_Tahir 96. Asma_Tahir Lv 1 1 pt. 7,842
  7. Avatar for Bithalbierer 97. Bithalbierer Lv 1 1 pt. 7,778
  8. Avatar for sulra001 98. sulra001 Lv 1 1 pt. 7,755
  9. Avatar for jamiexq 99. jamiexq Lv 1 1 pt. 7,742
  10. Avatar for knotartist 100. knotartist Lv 1 1 pt. 7,654

Comments