Placeholder image of a protein
Icon representing a puzzle

1762: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 2 pts. 9,530
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,129
  3. Avatar for Contenders 13. Contenders 1 pt. 9,064
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,786
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 8,737
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 8,737
  7. Avatar for Team Schleswig-Holstein 17. Team Schleswig-Holstein 1 pt. 7,778
  8. Avatar for STME 1903 18. STME 1903 1 pt. 3,334
  1. Avatar for HWANGBO EUN 111. HWANGBO EUN Lv 1 1 pt. 7,362
  2. Avatar for urehman 112. urehman Lv 1 1 pt. 7,018
  3. Avatar for 01010011111 113. 01010011111 Lv 1 1 pt. 6,936
  4. Avatar for veronicaahui 114. veronicaahui Lv 1 1 pt. 6,914
  5. Avatar for toshiue 115. toshiue Lv 1 1 pt. 3,334
  6. Avatar for lfurgus 116. lfurgus Lv 1 1 pt. 3,334
  7. Avatar for multaq 117. multaq Lv 1 1 pt. 3,334
  8. Avatar for hansvandenhof 118. hansvandenhof Lv 1 1 pt. 3,334
  9. Avatar for bkoep 119. bkoep Lv 1 1 pt. 3,334

Comments