Placeholder image of a protein
Icon representing a puzzle

1762: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 2 pts. 9,530
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,129
  3. Avatar for Contenders 13. Contenders 1 pt. 9,064
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,786
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 8,737
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 8,737
  7. Avatar for Team Schleswig-Holstein 17. Team Schleswig-Holstein 1 pt. 7,778
  8. Avatar for STME 1903 18. STME 1903 1 pt. 3,334
  1. Avatar for joremen 31. joremen Lv 1 24 pts. 9,768
  2. Avatar for Deleted player 32. Deleted player pts. 9,759
  3. Avatar for Glen B 33. Glen B Lv 1 21 pts. 9,752
  4. Avatar for neon_fuzz 34. neon_fuzz Lv 1 20 pts. 9,750
  5. Avatar for TastyMunchies 35. TastyMunchies Lv 1 19 pts. 9,721
  6. Avatar for 181818 36. 181818 Lv 1 18 pts. 9,716
  7. Avatar for alcor29 37. alcor29 Lv 1 17 pts. 9,679
  8. Avatar for haabermaaster 38. haabermaaster Lv 1 16 pts. 9,624
  9. Avatar for Anfinsen_slept_here 39. Anfinsen_slept_here Lv 1 15 pts. 9,604
  10. Avatar for RileyBugz1 40. RileyBugz1 Lv 1 14 pts. 9,603

Comments