Placeholder image of a protein
Icon representing a puzzle

1762: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 2 pts. 9,530
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,129
  3. Avatar for Contenders 13. Contenders 1 pt. 9,064
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,786
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 8,737
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 8,737
  7. Avatar for Team Schleswig-Holstein 17. Team Schleswig-Holstein 1 pt. 7,778
  8. Avatar for STME 1903 18. STME 1903 1 pt. 3,334
  1. Avatar for vuvuvu 51. vuvuvu Lv 1 7 pts. 9,129
  2. Avatar for ramlov6 52. ramlov6 Lv 1 6 pts. 9,127
  3. Avatar for JasperD 53. JasperD Lv 1 6 pts. 9,108
  4. Avatar for fpc 54. fpc Lv 1 6 pts. 9,076
  5. Avatar for georg137 55. georg137 Lv 1 5 pts. 9,064
  6. Avatar for bobcat 56. bobcat Lv 1 5 pts. 9,062
  7. Avatar for Alistair69 57. Alistair69 Lv 1 5 pts. 9,041
  8. Avatar for Arne Heessels 58. Arne Heessels Lv 1 4 pts. 8,989
  9. Avatar for roman madala 59. roman madala Lv 1 4 pts. 8,970
  10. Avatar for Pawel Tluscik 60. Pawel Tluscik Lv 1 4 pts. 8,955

Comments