Placeholder image of a protein
Icon representing a puzzle

1762: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 2 pts. 9,530
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,129
  3. Avatar for Contenders 13. Contenders 1 pt. 9,064
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,786
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 8,737
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 8,737
  7. Avatar for Team Schleswig-Holstein 17. Team Schleswig-Holstein 1 pt. 7,778
  8. Avatar for STME 1903 18. STME 1903 1 pt. 3,334
  1. Avatar for ppp6 71. ppp6 Lv 1 2 pts. 8,777
  2. Avatar for xbp 72. xbp Lv 1 2 pts. 8,758
  3. Avatar for navn 73. navn Lv 1 1 pt. 8,753
  4. Avatar for NewZealand 74. NewZealand Lv 1 1 pt. 8,737
  5. Avatar for alyssa_d_V2.0 75. alyssa_d_V2.0 Lv 1 1 pt. 8,737
  6. Avatar for Kim Ye-eun 76. Kim Ye-eun Lv 1 1 pt. 8,707
  7. Avatar for hada 77. hada Lv 1 1 pt. 8,672
  8. Avatar for Blipperman 78. Blipperman Lv 1 1 pt. 8,665
  9. Avatar for Threeoak 79. Threeoak Lv 1 1 pt. 8,662
  10. Avatar for rinze 80. rinze Lv 1 1 pt. 8,640

Comments