Placeholder image of a protein
Icon representing a puzzle

1762: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Void Crushers 100 pts. 10,347
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 10,305
  3. Avatar for Go Science 3. Go Science 54 pts. 10,215
  4. Avatar for Gargleblasters 4. Gargleblasters 38 pts. 10,127
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 10,102
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,084
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,041
  8. Avatar for Anthropic Dreams 8. Anthropic Dreams 8 pts. 9,965
  9. Avatar for Russian team 9. Russian team 5 pts. 9,882
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 3 pts. 9,624

  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 65 pts. 10,010
  2. Avatar for fiendish_ghoul 12. fiendish_ghoul Lv 1 62 pts. 9,992
  3. Avatar for Phyx 13. Phyx Lv 1 59 pts. 9,979
  4. Avatar for Idiotboy 14. Idiotboy Lv 1 56 pts. 9,952
  5. Avatar for jobo0502 15. jobo0502 Lv 1 54 pts. 9,948
  6. Avatar for grogar7 16. grogar7 Lv 1 51 pts. 9,943
  7. Avatar for dcrwheeler 17. dcrwheeler Lv 1 49 pts. 9,942
  8. Avatar for christioanchauvin 18. christioanchauvin Lv 1 46 pts. 9,895
  9. Avatar for Vinara 19. Vinara Lv 1 44 pts. 9,892
  10. Avatar for robgee 20. robgee Lv 1 42 pts. 9,887

Comments