Placeholder image of a protein
Icon representing a puzzle

1762: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 10,347
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 10,305
  3. Avatar for Go Science 3. Go Science 54 pts. 10,215
  4. Avatar for Gargleblasters 4. Gargleblasters 38 pts. 10,127
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 10,102
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,084
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,041
  8. Avatar for Anthropic Dreams 8. Anthropic Dreams 8 pts. 9,965
  9. Avatar for Russian team 9. Russian team 5 pts. 9,882
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 3 pts. 9,624
  1. Avatar for versat82 41. versat82 Lv 1 13 pts. 9,530
  2. Avatar for Hellcat6 42. Hellcat6 Lv 1 12 pts. 9,466
  3. Avatar for DoctorSockrates 43. DoctorSockrates Lv 1 12 pts. 9,447
  4. Avatar for alwen 44. alwen Lv 1 11 pts. 9,399
  5. Avatar for heather-1 45. heather-1 Lv 1 10 pts. 9,384
  6. Avatar for WBarme1234 46. WBarme1234 Lv 1 10 pts. 9,353
  7. Avatar for phi16 47. phi16 Lv 1 9 pts. 9,253
  8. Avatar for petetrig 48. petetrig Lv 1 8 pts. 9,247
  9. Avatar for Merf 49. Merf Lv 1 8 pts. 9,243
  10. Avatar for CAN1958 50. CAN1958 Lv 1 7 pts. 9,195

Comments