Placeholder image of a protein
Icon representing a puzzle

1762: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 10,347
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 10,305
  3. Avatar for Go Science 3. Go Science 54 pts. 10,215
  4. Avatar for Gargleblasters 4. Gargleblasters 38 pts. 10,127
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 10,102
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,084
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,041
  8. Avatar for Anthropic Dreams 8. Anthropic Dreams 8 pts. 9,965
  9. Avatar for Russian team 9. Russian team 5 pts. 9,882
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 3 pts. 9,624
  1. Avatar for lconor 81. lconor Lv 1 1 pt. 8,619
  2. Avatar for Pibeagles1 82. Pibeagles1 Lv 1 1 pt. 8,592
  3. Avatar for KpX 83. KpX Lv 1 1 pt. 8,589
  4. Avatar for cobaltteal 84. cobaltteal Lv 1 1 pt. 8,570
  5. Avatar for andromeda72 85. andromeda72 Lv 1 1 pt. 8,549
  6. Avatar for rylomorda 86. rylomorda Lv 1 1 pt. 8,492
  7. Avatar for kubek915 87. kubek915 Lv 1 1 pt. 8,315
  8. Avatar for boondog 88. boondog Lv 1 1 pt. 8,174
  9. Avatar for sujung 89. sujung Lv 1 1 pt. 8,149
  10. Avatar for harvardman 90. harvardman Lv 1 1 pt. 8,137

Comments