1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Summary

• Created: November 26, 2019
• Expires: December 04, 2019 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

• 11. Team New Zealand 2 pts. 10,145
• 12. FoldIt@Netherlands 1 pt. 10,112
• 13. Italiani Al Lavoro 1 pt. 10,108
• 14. Trinity Biology 1 pt. 9,976
• 15. Hold My Beer 1 pt. 9,864
• 16. SETI.Germany 1 pt. 9,413
• 17. Team Schleswig-Holstein 1 pt. 9,344
• 18. IB Bio 1 pt. 4,734

Top soloists

• 1. Aubade01 100 pts. 10,836
• 2. LociOiling 97 pts. 10,816
• 3. ZeroLeak7 93 pts. 10,782
• 4. Enzyme 90 pts. 10,721
• 5. Deleted player 86 pts. 10,657
• 6. Phyx 83 pts. 10,656
• 7. retiredmichael 80 pts. 10,639
• 8. Bruno Kestemont 77 pts. 10,608
• 9. aznarog 74 pts. 10,606
• 10. grogar7 71 pts. 10,557