Placeholder image of a protein
Icon representing a puzzle

1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Beta Folders 100 pts. 10,819
  2. Avatar for Go Science 2. Go Science 74 pts. 10,782
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,721
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,606
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,557
  6. Avatar for HMT heritage 6. HMT heritage 18 pts. 10,514
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 10,446
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,420
  9. Avatar for Contenders 9. Contenders 5 pts. 10,380
  10. Avatar for Russian team 10. Russian team 3 pts. 10,376

  1. Avatar for Aubade01
    1. Aubade01 Lv 1
    100 pts. 10,836
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 10,816
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 93 pts. 10,782
  4. Avatar for Enzyme 4. Enzyme Lv 1 90 pts. 10,721
  5. Avatar for Deleted player 5. Deleted player 86 pts. 10,657
  6. Avatar for Phyx 6. Phyx Lv 1 83 pts. 10,656
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 80 pts. 10,639
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 77 pts. 10,608
  9. Avatar for aznarog 9. aznarog Lv 1 74 pts. 10,606
  10. Avatar for grogar7 10. grogar7 Lv 1 71 pts. 10,557

Comments