Placeholder image of a protein
Icon representing a puzzle

1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Team New Zealand 11. Team New Zealand 2 pts. 10,145
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,112
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,108
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,976
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 9,864
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 9,413
  7. Avatar for IB Bio 18. IB Bio 1 pt. 4,734

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,819
  2. Avatar for Deleted player 2. Deleted player 73 pts. 10,808
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 52 pts. 10,788
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 36 pts. 10,768
  5. Avatar for silent gene 5. silent gene Lv 1 24 pts. 10,766
  6. Avatar for Phyx 6. Phyx Lv 1 16 pts. 10,752
  7. Avatar for ManVsYard 7. ManVsYard Lv 1 10 pts. 10,720
  8. Avatar for Blipperman 8. Blipperman Lv 1 6 pts. 10,703
  9. Avatar for O Seki To 9. O Seki To Lv 1 4 pts. 10,506
  10. Avatar for neon_fuzz 10. neon_fuzz Lv 1 2 pts. 10,441

Comments