1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Summary

• Created: November 26, 2019
• Expires: December 04, 2019 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

• 11. Team New Zealand 2 pts. 10,145
• 12. FoldIt@Netherlands 1 pt. 10,112
• 13. Italiani Al Lavoro 1 pt. 10,108
• 14. Trinity Biology 1 pt. 9,976
• 15. Hold My Beer 1 pt. 9,864
• 16. SETI.Germany 1 pt. 9,413
• 17. Team Schleswig-Holstein 1 pt. 9,344
• 18. IB Bio 1 pt. 4,734

Top evolvers

• 1. LociOiling 100 pts. 10,819
• 2. Deleted player 73 pts. 10,808
• 3. retiredmichael 52 pts. 10,788
• 4. Bruno Kestemont 36 pts. 10,768
• 5. silent gene 24 pts. 10,766
• 6. Phyx 16 pts. 10,752
• 7. ManVsYard 10 pts. 10,720
• 8. Blipperman 6 pts. 10,703
• 9. O Seki To 4 pts. 10,506
• 10. neon_fuzz 2 pts. 10,441