Placeholder image of a protein
Icon representing a puzzle

1767: Electron Density: Kinesin Coiled-Coil

Closed since over 6 years ago

Advanced Overall Prediction Electron Density

Summary

Created
December 03, 2019
Expires
Max points
100
Description

Fold a kinesin protein into an electron density map! We are giving you a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure of has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map!



Correct Sequence:


QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYD
QKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 13,909
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 13,900
  3. Avatar for Russian team 13. Russian team 1 pt. 13,869
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 13,741
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 12,339
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 9,792
  7. Avatar for BrownBiomolecular 17. BrownBiomolecular 1 pt. 8,728
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0
  1. Avatar for vinsi 121. vinsi Lv 1 1 pt. 7,852
  2. Avatar for Louise ALLAIN 122. Louise ALLAIN Lv 1 1 pt. 7,541
  3. Avatar for Quaternary Inquisitor 123. Quaternary Inquisitor Lv 1 1 pt. 7,539
  4. Avatar for Ale DT 124. Ale DT Lv 1 1 pt. 6,966
  5. Avatar for Jelle De Eiwit Vouwer 125. Jelle De Eiwit Vouwer Lv 1 1 pt. 6,558
  6. Avatar for charleswei 126. charleswei Lv 1 1 pt. 6,161
  7. Avatar for AdaniyaSBiol1300 127. AdaniyaSBiol1300 Lv 1 1 pt. 5,561
  8. Avatar for Donobit 128. Donobit Lv 1 1 pt. 5,502
  9. Avatar for luludu31 129. luludu31 Lv 1 1 pt. 5,429
  10. Avatar for RedStorm1024 130. RedStorm1024 Lv 1 1 pt. 5,135

Comments

beta_helix Staff Lv 1

Sorry about that, here is the correct sequence (updated in the description as well):

QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDEL
NQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG