Placeholder image of a protein
Icon representing a puzzle

1767: Electron Density: Kinesin Coiled-Coil

Closed since over 6 years ago

Advanced Overall Prediction Electron Density

Summary

Created
December 03, 2019
Expires
Max points
100
Description

Fold a kinesin protein into an electron density map! We are giving you a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure of has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map!



Correct Sequence:


QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYD
QKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 13,909
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 13,900
  3. Avatar for Russian team 13. Russian team 1 pt. 13,869
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 13,741
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 12,339
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 9,792
  7. Avatar for BrownBiomolecular 17. BrownBiomolecular 1 pt. 8,728
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0
  1. Avatar for Skippysk8s 11. Skippysk8s Lv 1 69 pts. 14,219
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 67 pts. 14,207
  3. Avatar for nicobul 13. nicobul Lv 1 64 pts. 14,206
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 62 pts. 14,206
  5. Avatar for silent gene 15. silent gene Lv 1 59 pts. 14,204
  6. Avatar for cbwest 16. cbwest Lv 1 57 pts. 14,201
  7. Avatar for Enzyme 17. Enzyme Lv 1 55 pts. 14,199
  8. Avatar for hpaege 18. hpaege Lv 1 53 pts. 14,193
  9. Avatar for Anfinsen_slept_here 19. Anfinsen_slept_here Lv 1 50 pts. 14,168
  10. Avatar for frood66 20. frood66 Lv 1 48 pts. 14,164

Comments

beta_helix Staff Lv 1

Sorry about that, here is the correct sequence (updated in the description as well):

QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDEL
NQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG